Protein Info for DVU3074 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 35 to 55 (21 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 103 to 120 (18 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 183 to 206 (24 residues), see Phobius details amino acids 217 to 236 (20 residues), see Phobius details amino acids 248 to 265 (18 residues), see Phobius details amino acids 271 to 288 (18 residues), see Phobius details PF00892: EamA" amino acids 7 to 142 (136 residues), 61.8 bits, see alignment E=4.3e-21 amino acids 157 to 287 (131 residues), 48.3 bits, see alignment E=6.6e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU3074)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726N2 at UniProt or InterPro

Protein Sequence (295 amino acids)

>DVU3074 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTDQGRAYMYGAATVGIWSTVATAFKLALRHLDPLQLLLVATIVSLLVLLTVLAWQGRLR
ELGSVCRADLARSALLGALNPFLYYVVLFEAYRLLPAQVAQPVNYTWAITLTLLSVPLLG
HRVTRGELLAVLVSYAGVVCIATRGDLATLAEGNLHGVALALASTVIWALYWIANTRSAL
EPVLGLTLGFAFGLPWVLGATLAFSSLPLSGEALRGLPAAAYVGAFEMGVSFIFWLKAMK
LTSSAARIGNLIFFSPFLSLVLISLVLGERILPTTLLGLACIVLGNLLQQRASRR