Protein Info for DVU3066 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: DNA-binding protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 PF13560: HTH_31" amino acids 6 to 59 (54 residues), 27 bits, see alignment E=1.6e-09 PF12844: HTH_19" amino acids 7 to 65 (59 residues), 33.1 bits, see alignment E=1.5e-11 PF13443: HTH_26" amino acids 10 to 67 (58 residues), 35.5 bits, see alignment E=3.4e-12 PF01381: HTH_3" amino acids 10 to 62 (53 residues), 39.5 bits, see alignment E=1.6e-13 PF07883: Cupin_2" amino acids 121 to 184 (64 residues), 56.5 bits, see alignment E=6.4e-19 PF02311: AraC_binding" amino acids 129 to 184 (56 residues), 30.7 bits, see alignment E=8.2e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU3066)

Predicted SEED Role

"Transcriptional regulator, MerR family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726P0 at UniProt or InterPro

Protein Sequence (189 amino acids)

>DVU3066 DNA-binding protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAAEKLGARVRKYREDRGMSREQLSEAAGLTVEFIAALEEDNLYPSIGPLQKVARALNVR
LGTFMDDEVTKDPIVARRGDREADLTMQKARNKRAAFRFHSLGKGKSDRNMEPFFIEICP
EPEEDRKLSSHQGEEFILVTKGRVRVVYGKEEQVLEPGDTIYYNSIVPHYVGAEGDDPAE
IYAVIYYPR