Protein Info for DVU3059 in Desulfovibrio vulgaris Hildenborough JW710

Name: ftsY
Annotation: signal recognition particle-docking protein FtsY (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 transmembrane" amino acids 442 to 460 (19 residues), see Phobius details PF02881: SRP54_N" amino acids 199 to 264 (66 residues), 57.1 bits, see alignment E=2.5e-19 TIGR00064: signal recognition particle-docking protein FtsY" amino acids 212 to 479 (268 residues), 329.5 bits, see alignment E=8e-103 PF06414: Zeta_toxin" amino acids 279 to 386 (108 residues), 23.2 bits, see alignment E=6.5e-09 PF00448: SRP54" amino acids 280 to 480 (201 residues), 249.7 bits, see alignment E=2.9e-78

Best Hits

Swiss-Prot: 100% identical to FTSY_DESVH: Signal recognition particle receptor FtsY (ftsY) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K03110, fused signal recognition particle receptor (inferred from 100% identity to dvu:DVU3059)

Predicted SEED Role

"Signal recognition particle receptor protein FtsY (=alpha subunit) (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division or Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726P7 at UniProt or InterPro

Protein Sequence (488 amino acids)

>DVU3059 signal recognition particle-docking protein FtsY (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MGFFSAIKRLWKGDTAPEDVSKPVEAEGSAIVGTSSTGSPVGTGAAMPAAQDAPSPAAPH
AIATPDDAVPDDAVPDDAVHGGEAPWKTELTLALRQAEPRLSVWLGHVLDGVDEAGPILW
ERLRFFFSSLEVPADEAETFVRDFGRWLEAMEYRYVADFRSELQYRLALALDLEDEEDER
SRLMLKLTEGLARTREQIGRRIDGLLASHGRIDEGFWEELEEILIMADVGFEPTTQLIGR
LRERARKAGTDDPARFRELLREELEVIFRAPRRIAAVNPPEVVLLIGVNGVGKTTTIAKL
AYRAQLQGRKVLIAAGDTFRAAAIEQLEIWAKRVGAGFYAKTAGADPAAVAYEAMDKAVS
EGYDLLLVDTAGRLHTKANLMEELHKIRKVLGRKHPGAPHRSILVIDATTGQNALSQTKL
FNEACGVDEIVLTKLDGTAKGGIVVAVAMQFGIPITYVGLGEKMEDMRPFNGSDFAMALL
GVEEKPAA