Protein Info for DVU3056 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: conserved hypothetical protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF02677: QueH" amino acids 4 to 175 (172 residues), 208 bits, see alignment E=6.1e-66

Best Hits

KEGG orthology group: K09765, hypothetical protein (inferred from 100% identity to dvu:DVU3056)

Predicted SEED Role

"FIG053235: Diacylglucosamine hydrolase like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726Q0 at UniProt or InterPro

Protein Sequence (217 amino acids)

>DVU3056 conserved hypothetical protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSRLLLHVCCGPCSIATVRMLRDEGYEVTGLFVNPNIHPLQEYLKRREAMQETAARLDLP
MIWRDDVYDVPAWLRGMAWREAPETRCRICYATRIETTLAVARHGGFDAFSTTLLYSRHQ
RHETIREVCEGAAADGPVSFVYRDFRTGWQEGIDTSRGWGIYRQQWCGCIYSENERHAAD
FSKATGRRPDSRRRAEGPVSSPPSGGGRTGRSPAQRG