Protein Info for DVU3030 in Desulfovibrio vulgaris Hildenborough JW710

Name: ackA
Annotation: acetate kinase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00016: acetate kinase
  • amino acids 2 to 398 (397 residues), 485 bits, E=7.9e-150
• PF00871: Acetate_kinase
  • amino acids 3 to 394 (392 residues), 503.9 bits, E=1.2e-155

Best Hits

Swiss-Prot: 100% identical to ACKA_DESVH: Acetate kinase (ackA) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K00925, acetate kinase [EC: 2.7.2.1] (inferred from 100% identity to dvl:Dvul_0343)

MetaCyc: 55% identical to AckA (Thermotoga maritima)
Acetate kinase. [EC: 2.7.2.1, 2.7.2.15]

Predicted SEED Role

"Acetate kinase (EC 2.7.2.1)" in subsystem Ethanolamine utilization or Fermentations: Lactate or Fermentations: Mixed acid or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Threonine anaerobic catabolism gene cluster (EC 2.7.2.1)

MetaCyc Pathways

• hexitol fermentation to lactate, formate, ethanol and acetate (16/19 steps found)
• Bifidobacterium shunt (13/15 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (7/8 steps found)
• pyruvate fermentation to acetate and lactate II (4/4 steps found)
• pyruvate fermentation to acetate I (3/3 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• pyruvate fermentation to acetate VII (3/3 steps found)
• superpathway of acetate utilization and formation (3/3 steps found)
• L-threonine degradation I (5/6 steps found)
• acetate and ATP formation from acetyl-CoA I (2/2 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
• mixed acid fermentation (12/16 steps found)
• acetylene degradation (anaerobic) (4/5 steps found)
• ethanolamine utilization (4/5 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
• superpathway of L-threonine metabolism (13/18 steps found)
• pyruvate fermentation to acetate II (2/3 steps found)
• glycine degradation (reductive Stickland reaction) (1/2 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (6/9 steps found)
• (S)-propane-1,2-diol degradation (3/5 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
• methanogenesis from acetate (2/6 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (4/9 steps found)
• acetyl-CoA fermentation to butanoate (2/7 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
• L-lysine fermentation to acetate and butanoate (2/10 steps found)
• purine nucleobases degradation I (anaerobic) (5/15 steps found)
• gallate degradation III (anaerobic) (2/11 steps found)
• superpathway of methanogenesis (2/21 steps found)
• superpathway of L-lysine degradation (5/43 steps found)

KEGG Metabolic Maps

• Propanoate metabolism
• Pyruvate metabolism
• Taurine and hypotaurine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.1 or 2.7.2.15

Sequence Analysis Tools

See Q726S6 at UniProt or InterPro

Protein Sequence (402 amino acids)

>DVU3030 acetate kinase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNVLVINSGSSSIKYQLIDMEREVPLCSGLVERIGEPMGKLTHKIRPDAEGEEKLTFEQP
FTNHVEGMKRVVELITDADKGVIKDKSEIGAIGHRVLLGGEEIKQSVRIDDWAKGVIRDY
IPLGPLHNPANLAGIEVAEELFPGLPNVGVFDTEFHQSMPAKAYLYPLPIELYEELKIRR
YGFHGTSHRYITKRTAQYLGKPLDELNIITCHLGNGCSMAAVKNGKCVDTTMGITPLEGL
MMGTRCGDIDPAIVPFLMEKKNLSPAEADTLMNKQSGLKGMCGMNDMRDLHAARENGNER
AQLAFEMFTYRIKKYIGAYYAVLGRVDAVVFTAGIGENDDFVRAEVCAGLDSLGIAVDPA
RNAVRNGQPRHISPDGSRVAVLVVPTNEELEIAQATLDVLKG