Protein Info for DVU3022 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensory box histidine kinase/response regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1139 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 353 to 376 (24 residues), see Phobius details PF04392: ABC_sub_bind" amino acids 80 to 326 (247 residues), 29.2 bits, see alignment E=2.2e-10 TIGR00229: PAS domain S-box protein" amino acids 387 to 509 (123 residues), 35.4 bits, see alignment E=5.4e-13 amino acids 512 to 632 (121 residues), 48.7 bits, see alignment E=4e-17 amino acids 634 to 760 (127 residues), 43.9 bits, see alignment E=1.2e-15 PF13188: PAS_8" amino acids 391 to 433 (43 residues), 21.8 bits, see alignment (E = 5.5e-08) amino acids 515 to 559 (45 residues), 31.9 bits, see alignment (E = 3.6e-11) amino acids 638 to 689 (52 residues), 18.6 bits, see alignment 5.5e-07 PF08448: PAS_4" amino acids 397 to 505 (109 residues), 33.3 bits, see alignment E=1.9e-11 amino acids 643 to 753 (111 residues), 49.5 bits, see alignment E=1.9e-16 PF13426: PAS_9" amino acids 405 to 502 (98 residues), 18.2 bits, see alignment E=1e-06 amino acids 653 to 752 (100 residues), 28.4 bits, see alignment E=6.8e-10 PF00989: PAS" amino acids 638 to 750 (113 residues), 35.3 bits, see alignment E=4.2e-12 PF00512: HisKA" amino acids 770 to 830 (61 residues), 29.4 bits, see alignment 2.6e-10 PF02518: HATPase_c" amino acids 876 to 997 (122 residues), 82.1 bits, see alignment E=1.6e-26 PF00072: Response_reg" amino acids 1019 to 1129 (111 residues), 63.1 bits, see alignment E=1e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU3022)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726T4 at UniProt or InterPro

Protein Sequence (1139 amino acids)

>DVU3022 sensory box histidine kinase/response regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MHTQPAIKALLQRALCAIVLCLCCVLCAPPAPAHADASRKAVLYLNSYHNGYSWSDDILA
GIRKVLEASGRALVFQVEYMDSKKFLYKETEQTLYRLYRDKFRDTRFDLIIASDNAAMDF
LTRFRDELFPGVPVVFCGLNDVKPESLRGRNMTGVIEDYDVAANIELALRFNPQLRRMVI
IGDDSVTGAAIRNQVMAQVAPLRDRIEVEEWTDYRLDQMLAWVREQPADTFFYFVPIYRD
IGGLFYTAEELLQKVRANSRAPLYSNWEFLLDHGIVGGKLISGVRHGEMAAELALRVLDG
EKADAIPIIERADEEYMFDNKELTRLFISRSMLPPGSVVINEPSRFYELNKQVFWTIIIS
LVILSLTLVLLVMNILDKRRVEGKIKDQLSYLRQLTDTIPLPVYSKDADGRIRECNLAFL
QFFSVERESVLGRYEWQAGERLALLRNAVDTDLMREPGQAAYDDTLPGPDGEARNVIVHK
ATYSNARGAIAGLVGVVVDYTDRKRAEDSLRAAEEKYRSIFESSPLGIFRLSPEGSLSDA
NPAFARMAGYDSSPAIMKQGRPAMDALLSGLDLARVGHEGILTWVADVQRPDGNRCTMHL
TLLIRRDALGALRLVEGYAEDITKRKETERALSASQRMLRLVLDNIPQFVYWTDRDLRFI
GANRSFLTFFGFAESHDISGLTMNDILTTAVHWIVQEANHAVIETGNPRYQSKLTITSPA
GEKVWLETSRVPLMGERGDVVGLLTTAEDVTQRIHLERQLLQSQKMEAIGTLAGGISHDF
NNILTSIINSIELAINDVAADSLTFTDLMRALKAAQRGSRLVKQILTFSRPSVEGFTTVD
LNEVVTEALVLIKASMPRNIQVRTAVPPDPSITRADPTQLHQVIMNLCTNSFHALRESGG
VLDINLEQEPIGPEEAHAFGVEPGCWLRLTVSDNGPGIPQEILDKIFDPFFTTKGKTEGT
GLGLAVVHGIIKGHRGAIRVSSLAHRRTAFEILLPMQEQTECPLSPADAPAPHEGHGRIL
FVEDDDDQLHTIPRVLESLGYSVRAFKNPLRALEALREHPAMFDLVLTDFDMPEANGLEL
AAKIGDIAPQVPVILVSGREVAAEGAARAGNIRTMIHKPYNRNIIADALARVLSRSGSA