Protein Info for DVU3021 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: HDIG domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 308 to 326 (19 residues), see Phobius details PF08668: HDOD" amino acids 188 to 383 (196 residues), 218.9 bits, see alignment E=4.9e-69 PF01966: HD" amino acids 283 to 402 (120 residues), 28.2 bits, see alignment E=2.1e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU3021)

Predicted SEED Role

"HDIG domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726T5 at UniProt or InterPro

Protein Sequence (456 amino acids)

>DVU3021 HDIG domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MVLPGFFVPVKGWCPLPGVVIFTDVPAVVPATVSAHEAACPAGSPVLPRVSGLPPLRDGS
RGRDCPMGASHVWDLPFSPPAGAALPCRRSRSHGLAPAPRVYGMLLVRAWRCSMDRDTVA
GLMADALLERRFRHNDGAHPALAALRELAVNQGTDAGRRMVADDPHEVGSPPLSPIDPVE
LLQHDGALPSLPTVYVELRQRLADPDCSVREAAEVITRDAGLTAWLLRVVNSASYGLSGR
VDTVTQAVAVVGMRQLETMVASGMLQSLMRSVPRGLVDMERLWRHSLAVGGAAREIWRLM
GRPDPERLFVAGVLHDVGYLAFVMMAPQKAAQLVPRLRASHLPGHLAERELLGFDHAKLG
GMLLHKWNMPVPLVMSVLRHHEPESVPSMPEPSVIHLADIVARAMGYGPDAESAVPPLSA
SAWEASGLTPQHLEAVANAMTAMVDDLGTAVMCTTV