Protein Info for DVU3019 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: radical SAM/B12 binding domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 PF02310: B12-binding" amino acids 20 to 136 (117 residues), 91.3 bits, see alignment E=4.1e-30 PF04055: Radical_SAM" amino acids 211 to 371 (161 residues), 64.8 bits, see alignment E=1.1e-21

Best Hits

KEGG orthology group: K04035, magnesium-protoporphyrin IX monomethyl ester (oxidative) cyclase [EC: 1.14.13.81] (inferred from 100% identity to dvl:Dvul_0353)

Predicted SEED Role

"Radical SAM domain protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.81

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726T7 at UniProt or InterPro

Protein Sequence (485 amino acids)

>DVU3019 radical SAM/B12 binding domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKVLCINPPDDLAALLGDGASFVSTMEPLGLLYVAAACREAGHEVAFIDAYAENLDEETL
MRRIRDAAPQVVSFTSFTSNGGFLYTFGRRLRQEMPGVHVLLGNVHATIYARQYLASGCC
DVVVRGEGEEVMPALLRVLEEGGDLATVPSIAYVRDGVVAETGGHAFVRDLSTLPLPARD
LTRKELYSFARTPNFSLYRTPEGKTEKHLFSSRGCVNRCTFCVAHKNIGIRVRPIDSVIG
EVDLLLREYDAGYIFFCDSLFTSRKKRIIELSDALRHHFPGLRWGCEAHVNTIDEDSVRA
MAAGGCVDMNFGIESGVDRLLTAVNKRQTTAQIADAIRMVKRVSRINAIGLFILGLPGER
PEDSDATIDFACSLPLDMAQFSILTPYPGSPIFEQLRAEGIIDDGVRPGDTLDPEVWRRY
SSYASFSDNKPIWVTPEHSVEGLLAAQKRALRRFYLRPRPFLIQLRRLRPADLLDTARTF
FKTFF