Protein Info for DVU3017 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: conserved domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07021: MetW
  • amino acids 89 to 197 (109 residues), 33.2 bits, E=1.3e-11
• PF13489: Methyltransf_23
  • amino acids 90 to 234 (145 residues), 74.7 bits, E=2.3e-24
• PF13847: Methyltransf_31
  • amino acids 94 to 195 (102 residues), 39.3 bits, E=1.6e-13
• PF08242: Methyltransf_12
  • amino acids 98 to 186 (89 residues), 39.5 bits, E=2.4e-13
• PF08241: Methyltransf_11
  • amino acids 98 to 188 (91 residues), 35.1 bits, E=5.1e-12
• PF13649: Methyltransf_25
  • amino acids 98 to 184 (87 residues), 30.5 bits, E=1.5e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU3017)

Predicted SEED Role

"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• L-glutamate and L-glutamine biosynthesis (4/7 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

See Q726T9 at UniProt or InterPro

Protein Sequence (302 amino acids)

>DVU3017 conserved domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
VQHGHCPLCAVRLAPAFAHVPDYEYGAEGDFGFGHCAECGLLVLTPQPGIEQLKAAYPPH
YHGFHTGAKGLVGLLYRLVYGLRVRAYGRLLPRGGRLLDVGCADAAYFDALVKARPDVVP
EGVEFIDDIAQRARDRGFRVVTGTLADMKDAEPYDVIIMNNLIEHVTDPVAELEQAVRLL
RPGGHIVVETPNTDSWDYAVAGRWWGGLHVPRHTYLFGPVSLDRLAALCGLRLASRSFQP
NTDHWALSVQNRLQATPSTRRPLTRGRAWYYKWLLLAFLPLNIVQAWLRKSGSFVSVYRR
TS