Protein Info for DVU3010 in Desulfovibrio vulgaris Hildenborough JW710

Name: lpsC
Annotation: aminotransferase, DegT/DnrJ/EryC1/StrS family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 PF01041: DegT_DnrJ_EryC1" amino acids 16 to 383 (368 residues), 442.7 bits, see alignment E=2.3e-136 PF01053: Cys_Met_Meta_PP" amino acids 37 to 212 (176 residues), 33 bits, see alignment E=5.1e-12 PF01212: Beta_elim_lyase" amino acids 38 to 291 (254 residues), 35.5 bits, see alignment E=1.4e-12 PF00155: Aminotran_1_2" amino acids 41 to 169 (129 residues), 34.8 bits, see alignment E=2.2e-12

Best Hits

Swiss-Prot: 50% identical to SPSC_BACSU: Spore coat polysaccharide biosynthesis protein SpsC (spsC) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to dvu:DVU3010)

Predicted SEED Role

"UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase (EC 2.6.1.-)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) (EC 2.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.-

Use Curated BLAST to search for 2.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726U6 at UniProt or InterPro

Protein Sequence (392 amino acids)

>DVU3010 aminotransferase, DegT/DnrJ/EryC1/StrS family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSFTPASAFIPFSPPQIGPEEEHELLEALRSGWITTGPRVRAFEAATAAVAGATHGVATF
SCTDAMLVALAAFGVGPGDEVITTPYTFISTAQVILHRGARPVFVDVDPRTFNIDPARIE
AAITPRTRGIMPVHFAGQVCDMDAILAIARRHGLFVIEDAAHAFGATHNGHPVGTLGDVA
CFSFYATKNITTAEGGMAVTSDADLAQRMRVLSMYGISDAREIWQKRYTRAGNIHYDVQE
LGYKCNMTDLCAALGLVQLRRMDAIAAARRSYAAIYDEAFADLPVTTPHVAPYAGHAWHL
YPLRLDLDRISLSRDEVILRLKECNVGTSVMFTPLHLFSYFQREMGFNEGDFPVAEDLFS
RVVCLPMSPALGEERIRKVAETVAHVVTEGAR