Protein Info for DVU2996 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: NAD-dependent epimerase/dehydratase family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 3 to 218 (216 residues), 33.3 bits, see alignment E=5.7e-12 PF01370: Epimerase" amino acids 4 to 217 (214 residues), 147.3 bits, see alignment E=1.1e-46 PF16363: GDP_Man_Dehyd" amino acids 5 to 293 (289 residues), 110.8 bits, see alignment E=2e-35

Best Hits

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 100% identity to dvu:DVU2996)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726W0 at UniProt or InterPro

Protein Sequence (307 amino acids)

>DVU2996 NAD-dependent epimerase/dehydratase family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MATVLVTGATGFIGSHVVEALAPRHDVVGLASSVYPSPRDAVRHVRMTLPHPDLEELVAT
LRPDVVVHCAGVASVGLSMHSPGVDFQSGPPVVFQLFDAIRKAGLASKVVLLSSAAVYGN
PQSLPVGEDAPRAPISPYGWHKGMCEDIAQEFHGTYGIRSAVLRIFSCYGAGLRKQLLWD
AAHKLLEGAFVFDGTGDETRDFIHVRDVAAFVTRLVEGWPDGGCVVCNVASGEATRIADL
LALLPEAFGLSGVVPVFTGRVRGGDPHHWRADISRARQMGLAPAVSLEEGVREYATWFFA
VTGGERA