Protein Info for DVU2989 in Desulfovibrio vulgaris Hildenborough JW710

Name: pspF
Annotation: psp operon transcriptional activator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 TIGR02974: psp operon transcriptional activator" amino acids 17 to 374 (358 residues), 479 bits, see alignment E=4.2e-148 PF14532: Sigma54_activ_2" amino acids 17 to 187 (171 residues), 68.4 bits, see alignment E=2e-22 PF00158: Sigma54_activat" amino acids 17 to 181 (165 residues), 190.7 bits, see alignment E=4.1e-60 PF07728: AAA_5" amino acids 39 to 158 (120 residues), 28.9 bits, see alignment E=2.6e-10 PF02954: HTH_8" amino acids 335 to 367 (33 residues), 23.1 bits, see alignment 1.2e-08

Best Hits

KEGG orthology group: K03974, psp operon transcriptional activator (inferred from 100% identity to dvu:DVU2989)

Predicted SEED Role

"Psp operon transcriptional activator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726W7 at UniProt or InterPro

Protein Sequence (381 amino acids)

>DVU2989 psp operon transcriptional activator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRSDALIPTHPGLAEALGQSEAFLAFQEELSRVAKVDRPVLLVGERGTGKELAAARLHFL
SRRWQGPFVILDGASLSPSLAEAELFGHEAGAFTGAAMRRPGRFERADGGTLFLDEAGNL
PLSVQDKLLRVVEYGQYERVGGTQRLEADVRIVAATNADLPGLVRQGRFRADLLDRLAFC
VLHLPPLRARGDDVLLLAEHFATRFAMEAGLPEPEFSTQARRALLTYAWPGNIRELRNTI
ERCVLKAEGGIITALDTTPFASPWQHGPAVHADATAVSTPAGGGATPGPASAPDIDPADT
AMQHGDSGTATTTPTASSPNPQAWTQGTTLPDAVRHLEEDALRGALARTRHNRRAAAELL
GLTYDQFRGLYRRHRDAIEKT