Protein Info for DVU2986 in Desulfovibrio vulgaris Hildenborough JW710

Name: pspC
Annotation: phage shock protein C (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 transmembrane" amino acids 46 to 75 (30 residues), see Phobius details TIGR02978: phage shock protein C" amino acids 21 to 138 (118 residues), 137.1 bits, see alignment E=1.3e-44 PF04024: PspC" amino acids 22 to 77 (56 residues), 51.5 bits, see alignment E=3.5e-18

Best Hits

KEGG orthology group: K03973, phage shock protein C (inferred from 99% identity to dvl:Dvul_0386)

Predicted SEED Role

"Phage shock protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726X0 at UniProt or InterPro

Protein Sequence (140 amino acids)

>DVU2986 phage shock protein C (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSRYHGRRGQCRDGFGSYGASRLYRARDGKFMGVCQGLADHFCLSVFWVRVLVVFAALFS
GFWPVLGIYVLMGLILKPRPVLPFETDSDRRFYDDCVRSRTSALARLKERCERLDNRLRR
MEDVVTRRDFDWERRFRTGT