Protein Info for DVU2979 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: phosphatidylserine decarboxylase-related protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 13 to 44 (32 residues), see Phobius details TIGR00164: phosphatidylserine decarboxylase homolog" amino acids 22 to 214 (193 residues), 194.4 bits, see alignment E=7.5e-62 PF02666: PS_Dcarbxylase" amino acids 42 to 210 (169 residues), 164.8 bits, see alignment E=1e-52

Best Hits

Swiss-Prot: 100% identical to PSD_DESVH: Phosphatidylserine decarboxylase proenzyme (psd) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 100% identity to dvl:Dvul_0393)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726X7 at UniProt or InterPro

Protein Sequence (217 amino acids)

>DVU2979 phosphatidylserine decarboxylase-related protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRNPSISITPEGLPAIGLCTLATLTFALIGCWVMAVIFLLLTWFCCHFFRDPERVTPTGA
GLAVSPADGRVIRVEPVTDPITGEKRTCVCIFMNVFNVHVNRMPVAGTIRNIVYHPGKFF
NAAWDKAATDNERCDYLIEDAEGGKWTMVQIAGLIARRIVCRVDEGDTLTRGERYGMIRF
GSRVDLYLPDGYCPTVSVGEHVFAGQTIVARKSPEGA