Protein Info for DVU2972 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: chemotaxis protein CheD, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to CHED_DESVH: Probable chemoreceptor glutamine deamidase CheD (cheD) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K03411, chemotaxis protein CheD [EC: 3.5.1.44] (inferred from 100% identity to dvu:DVU2972)

Predicted SEED Role

"Chemotaxis protein CheD" in subsystem Bacterial Chemotaxis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726Y4 at UniProt or InterPro

Protein Sequence (199 amino acids)

>DVU2972 chemotaxis protein CheD, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRDAVRAKTNRRSVAGMPAELMDLDLRHLHLRIGEGILAARPALIATVLGSCVSVTFHHP
STETGGIFHAMLPTVLGAADGARTPCKYVDAAIETLLGQFARRGIAANDLVVKLFGGAFT
MNPEEKQRLRCIVDVGGRNVEVARATLQRFGIEPQSEHILGDRGRKLFFHSGTGEVWVRL
LRRTEPPLPSALVCRDDLT