Protein Info for DVU2970 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: acetyltransferase, GNAT family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 898 PF02629: CoA_binding" amino acids 11 to 103 (93 residues), 34.2 bits, see alignment E=1.1e-11 PF13380: CoA_binding_2" amino acids 14 to 139 (126 residues), 76.7 bits, see alignment E=5.9e-25 PF13607: Succ_CoA_lig" amino acids 156 to 293 (138 residues), 173.6 bits, see alignment E=5.6e-55 PF13549: ATP-grasp_5" amino acids 483 to 698 (216 residues), 236.3 bits, see alignment E=8.1e-74 PF13302: Acetyltransf_3" amino acids 730 to 869 (140 residues), 31.6 bits, see alignment E=7.2e-11 PF00583: Acetyltransf_1" amino acids 776 to 868 (93 residues), 34.2 bits, see alignment E=8.6e-12

Best Hits

KEGG orthology group: K09181, hypothetical protein (inferred from 100% identity to dvl:Dvul_0400)

Predicted SEED Role

"Protein acetyltransferase" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726Y6 at UniProt or InterPro

Protein Sequence (898 amino acids)

>DVU2970 acetyltransferase, GNAT family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSHSPLEQMFKPTSVVVVGATADENTPGNRIMRNLLAGTFLGPVLPVNDTGEAVAGMPGH
TAIDTLPLTPDLAIICSPPESVAEHIAELGKRGTRAVVVLSQGFYRYDGERREVQRNAVL
QAARRHGVRVLGPNCLGFVSPAVGINASLMPRKALPGKVAFVSQSDSLFSTVLDWATSKK
IGFSHCIALGDRYDIHFHDILDYLNSDVNTRAVLLYLETIDKARRFMSAARALARNKPVL
VVKSGRSAEGAAAAAAHSGMPLGADDVYDAAFRRAGMLRVADIDTLFNAVEALALARPLK
GERLAILTNGGSPGFIATDALIRGGGTLADLSDATCQLLDDSLGRDWSYWNPLVMRSSAG
GELYARALNHLLEDRGVDAVLAMHVPSYAVPSEEVAEAVTKVARRSKKVVLTSWLGIDDA
EAARRHFTAQGVPTFFTPDSAVRAFLNLVEFRRNQDLLMETPPSLPDDFMPDALAARRVV
NDALEAKRQILDPAEARAVLEAYGIPVAEALHVREPREVVEAAVRLGYPVAIKVESPDVA
RRSVVGGVALDVKTDEEALDAALVTAERVCAQVPGARMTGFTVQRMCHIGAGSELAVETA
TDPVFGPVIRFGQGGAASETYPDRATGLPPLNLGLAQELMSRTRAGRTLRPAETGAVKLL
LVKVSQLIIDIPEIFELEIDPLFADDDGIVALDAHIRIAWTTRSGTDQLAIRPYPRELEE
HAHLRDGREVLLRPIRPEDEPDHWAFVEHLSAEDKRFRFFGNVAQLPRSEMVKLTQIDYD
REMAFIARGPGEDGATTTLGVVRAMASPDNSEAEFAVAVRSDLKRQGLGRMLMEKIIRYC
RTRGTRRIVGAALGDNKAMAELARAVGFVVSKNYDEDTWQLDLPLADPQDKSPDDARS