Protein Info for DVU2962 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensor histidine kinase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 577 transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 299 to 322 (24 residues), see Phobius details PF02743: dCache_1" amino acids 72 to 281 (210 residues), 50.7 bits, see alignment E=2.6e-17 PF00512: HisKA" amino acids 349 to 416 (68 residues), 34.1 bits, see alignment E=3.4e-12 PF02518: HATPase_c" amino acids 462 to 568 (107 residues), 84.2 bits, see alignment E=1.3e-27

Best Hits

KEGG orthology group: K02482, two-component system, NtrC family, sensor kinase [EC: 2.7.13.3] (inferred from 100% identity to dvl:Dvul_0408)

Predicted SEED Role

"Two-component sensor PilS" in subsystem Type IV pilus

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726Z4 at UniProt or InterPro

Protein Sequence (577 amino acids)

>DVU2962 sensor histidine kinase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKNPLGTMLSRLRSVFDVPDEIAPERYRMLRRKITLLMTAVSVLPLLILTAVSYHQYQST
LTREIVTPVRALVNKTRHSFELFLAERSSTVSLLAKTYSMAELSDEKNLNRIFLALKGEF
PGFVDLGVIDGRGVQVGYVGPYDVRGKNYSEADWYNRTRVKGVYISDVFMGFRRFPHIAI
AVQRMNPDGSSWMLRATIETTQFDRLIASMGLDPESDAFLINTAGVLQTNSRFYGNVLDV
MPMPVPHLSYEPSIIDTEDPEGRQIFLSSAFLQNADFAIVAVKPKTEILRPWTSLRSDLL
IFVAFSVALIISAAFGFTDMLVRRMRDSDERRIAAFVQIEHTQKLSSIGRLAAGVAHEIN
NPLAIINEKAGLAADLIALSQDFPQKERFSAIVEAISRSVDRCRSITHRLLGFSRRMDAT
YEQLDVNGILKETMSFLEQEAVHRSITIGTSLDAGLPRITSDRGQLQQVFLNIINNAFAA
VQDGGSVTLTTFAADGGMVGVSIQDNGKGMSEEVQRHIFEPFFTTKKTAGTGLGMFITYG
IIKRLGGEIGINSREGVGTTVTVYLPQDAPAPQSLEN