Protein Info for DVU2958 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 56 to 97 (42 residues), see Phobius details amino acids 103 to 120 (18 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details amino acids 254 to 264 (11 residues), see Phobius details amino acids 270 to 274 (5 residues), see Phobius details amino acids 279 to 303 (25 residues), see Phobius details amino acids 309 to 327 (19 residues), see Phobius details PF01925: TauE" amino acids 63 to 324 (262 residues), 126.7 bits, see alignment E=6.2e-41

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to dvl:Dvul_0412)

Predicted SEED Role

"FIG00602685: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726Z8 at UniProt or InterPro

Protein Sequence (332 amino acids)

>DVU2958 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKTRNATRLLCLLTCVALAGVALLLMAMPATATSAAQDVAQSVTQSAAALPGNHPWWFWP
TTLLFFCFILGIIAVLAGVGGGVLFVPLVSGFFPFHLDFVRGAGLLVALAGALAAGPGLL
KRNLASLRLALPVALIASSCAIVGAMLGLALPTNIVQIFLGATILFIACLLLFSKNSVRP
EVKQQDAIGLALGLQGAFIEPTTGETVEWKTHRTLPGLLLFIIIGIMAGMFGLGAGWANV
PVLNLLMGVPLKVAVGTSKFLLSITDTSAAWVYLNQGCVIPLMAIPSIVGLMLGSVVGVR
LLAVAKPKFIRYMVIGVLIFAGAKALLKGLGI