Protein Info for DVU2956 in Desulfovibrio vulgaris Hildenborough JW710

Name: flrA
Annotation: sigma-54 dependent transcriptional regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF00158: Sigma54_activat" amino acids 37 to 198 (162 residues), 208 bits, see alignment E=2e-65 PF14532: Sigma54_activ_2" amino acids 38 to 203 (166 residues), 57.5 bits, see alignment E=4.7e-19 PF07728: AAA_5" amino acids 55 to 174 (120 residues), 24.3 bits, see alignment E=7.1e-09 PF25601: AAA_lid_14" amino acids 204 to 282 (79 residues), 80.6 bits, see alignment E=1.6e-26 PF02954: HTH_8" amino acids 301 to 341 (41 residues), 51.7 bits, see alignment 1.4e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2956)

Predicted SEED Role

"sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727A0 at UniProt or InterPro

Protein Sequence (345 amino acids)

>DVU2956 sigma-54 dependent transcriptional regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSGKKLPHSGNSLPIEGTVSPQRETLQNGTDFLLLSGVMQRLRVLASQVASSDAPVLIHG
ETGTGKELFARLIHDMGIRAKKPFVAVNCGVHEGELFADKFFGHEQGAFTGAHRMSQGCF
ELASEGTLFLDEVGEIPGANQADFLRVLEEKRFRRIGGQRDIPFQARIVAASNRDLQEMV
GQGQFRADLFYRLNVIPVVLPPLRARKEEVVPLARHFLTHYGDKYHRPGVRFAPETEQAL
AAYQWPGNVRELKNLVERIALLAPEGVLGPEHLPLELRSAAAVEVGVPHEVPEDLSLDRA
RREAEVRVILKAMRATGGNKGEAARLLGVSPRTLRYKFAEYALRF