Protein Info for DVU2934 in Desulfovibrio vulgaris Hildenborough JW710

Name: ntrX
Annotation: sigma-54 dependent transcriptional regulator/response regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 PF00072: Response_reg" amino acids 5 to 112 (108 residues), 111.1 bits, see alignment E=9.7e-36 PF00158: Sigma54_activat" amino acids 143 to 309 (167 residues), 247.9 bits, see alignment E=1.3e-77 PF14532: Sigma54_activ_2" amino acids 144 to 314 (171 residues), 77.1 bits, see alignment E=5e-25 PF07728: AAA_5" amino acids 167 to 286 (120 residues), 23.2 bits, see alignment E=1.8e-08 PF00004: AAA" amino acids 167 to 285 (119 residues), 21.6 bits, see alignment E=7.8e-08 PF02954: HTH_8" amino acids 427 to 465 (39 residues), 32.7 bits, see alignment 1.5e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2934)

Predicted SEED Role

"Nitrogen regulation protein NtrX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727C1 at UniProt or InterPro

Protein Sequence (472 amino acids)

>DVU2934 sigma-54 dependent transcriptional regulator/response regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPARILIIDDEDDIRFSLRGILEDEGHEVTEAPDGEAGLRTLASDTPDVVFLDIWMPGMD
GLTVLEHIHAAAPSLPVIMISGHGTIETAVAAIKKGAHDFIEKPLSLEKVVIAAERALEM
RELRRENQALRSSLGAGSKADELIGESAPMRRIREQIARVAPTDAWVLITGENGTGKELA
ARAVHAGSQRATRPLVAVNCAAIPEELIESELFGHEKGAFTGAESARTGKFEMAHRGTLF
LDEIGDMSLKTQAKILRILQEQSFEKVGGTRTIRVDVRVVAATNKNLEEQIAQGTFREDL
YYRLRVFPLSLPALRERGDDILRLLDAFMLRLCRDHAFAPLTFTDDAQDVLLRYRWPGNV
RELRNFVERMLILHAGESVDVEDLPPECLRDLSPSSDSATGTAAQSATATCGTGVDGILD
FKAARNAFETRFLAEQLQECGGNVSRLAERIGLERSHLHRKLKGYGIIAGDQ