Protein Info for DVU2933 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: response regulator/sensory box/HDIG domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 PF00072: Response_reg" amino acids 5 to 113 (109 residues), 76.4 bits, see alignment E=6.8e-25 TIGR00229: PAS domain S-box protein" amino acids 129 to 178 (50 residues), 25.5 bits, see alignment 1.2e-09 PF13188: PAS_8" amino acids 135 to 188 (54 residues), 28.8 bits, see alignment 3e-10 PF00989: PAS" amino acids 138 to 247 (110 residues), 40.4 bits, see alignment E=9.3e-14 PF08448: PAS_4" amino acids 139 to 252 (114 residues), 60.9 bits, see alignment E=4.6e-20 PF13426: PAS_9" amino acids 143 to 249 (107 residues), 43.2 bits, see alignment E=1.4e-14 PF13487: HD_5" amino acids 280 to 439 (160 residues), 134.2 bits, see alignment E=1.5e-42 TIGR00277: HDIG domain" amino acids 286 to 376 (91 residues), 41.9 bits, see alignment E=7.1e-15 PF01966: HD" amino acids 287 to 408 (122 residues), 74.2 bits, see alignment E=3.7e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_0434)

Predicted SEED Role

"Response regulator/sensory box/HDIG domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727C2 at UniProt or InterPro

Protein Sequence (458 amino acids)

>DVU2933 response regulator/sensory box/HDIG domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRYDILLVEDEAVVACDVRHRLERLGYAPARLATNGAEALRMFNERTPDVVLMDIVLDGP
MDGIELAGHIRAEAHTPIIYLTGHAAPDILHRAKITEPFGYILKPFEDRELHICIEMAIY
KSRVDNDLRAKERWFASTLRSIPDAVVTVDGAGRITYCNDSAERLTHQPRAELLGARFGQ
SIPLCDALRTDYTDPAALVAPGYGPLHFSDAATLGTPSGSVPVEIRISPLHDANGTDAGA
VLVMRDVTERRRAEETLHATLDDLQRAFRQTVSALAATSEKRDPYTAGHQARVAQLACAL
ASRLDLGAHAIEGVRVAAMLHDIGKIHIPSEILAKPTRLSDLEMSIMRMHSEVGHDILRE
ISFPWPVADIVLQHHERLDGSGYPHGLAGDAILPAARIIAVADVVEAMSSHRPYRPARGL
GLAFDEIMSGRGARYDAAVVDACQSLFAEGFTFDQPNG