Protein Info for DVU2927 in Desulfovibrio vulgaris Hildenborough JW710

Name: rplL
Annotation: ribosomal protein L7/L12 (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 TIGR00855: ribosomal protein bL12" amino acids 1 to 127 (127 residues), 158.6 bits, see alignment E=4.7e-51 PF16320: Ribosomal_L12_N" amino acids 4 to 51 (48 residues), 72.9 bits, see alignment E=1.3e-24 PF00542: Ribosomal_L12" amino acids 61 to 127 (67 residues), 102.9 bits, see alignment E=9.5e-34

Best Hits

Swiss-Prot: 100% identical to RL7_DESVH: 50S ribosomal protein L7/L12 (rplL) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K02935, large subunit ribosomal protein L7/L12 (inferred from 100% identity to dvl:Dvul_0440)

MetaCyc: 58% identical to 50S ribosomal subunit protein L12 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L7/L12 (P1/P2)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727C8 at UniProt or InterPro

Protein Sequence (127 amino acids)

>DVU2927 ribosomal protein L7/L12 (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSITKEQVVEFIGNMTVLELSEFIKELEEKFGVSAAAPMAAMAVAAPAGDAAPAEEEKTE
FDIILKSAGANKIGVIKVVRALTGLGLKEAKDKVDGAPSTLKEAASKEEAEEAKKQLVEA
GAEVEIK