Protein Info for DVU2920 in Desulfovibrio vulgaris Hildenborough JW710

Name: tuf
Annotation: translation elongation factor Tu (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 TIGR00485: translation elongation factor Tu" amino acids 1 to 397 (397 residues), 749.7 bits, see alignment E=5.8e-230 PF00009: GTP_EFTU" amino acids 10 to 204 (195 residues), 219.5 bits, see alignment E=4.4e-69 TIGR00231: small GTP-binding protein domain" amino acids 13 to 148 (136 residues), 54.8 bits, see alignment E=9.3e-19 PF03144: GTP_EFTU_D2" amino acids 228 to 297 (70 residues), 68.5 bits, see alignment E=8.6e-23 PF03143: GTP_EFTU_D3" amino acids 301 to 395 (95 residues), 136.2 bits, see alignment E=7.8e-44

Best Hits

Swiss-Prot: 100% identical to EFTU_DESVH: Elongation factor Tu (tuf) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K02358, elongation factor Tu (inferred from 100% identity to dvl:Dvul_0447)

Predicted SEED Role

"Translation elongation factor Tu" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727D5 at UniProt or InterPro

Protein Sequence (397 amino acids)

>DVU2920 translation elongation factor Tu (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MGKEKFERKKPHVNIGTIGHIDHGKTTLTAAITKTAGLLGQGKFIAYDEIDKAPEEKERG
ITIATAHVEYETATRHYAHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGPMPQTREHI
LLARQVGVPYIVVFLNKCDMVDDEELLELVELEVRELLTSYGFPGDDVPVVRGSALKALE
SDDPNSDACKPIRELLAACDSYIPEPQRDIDKPFLMPIEDVFSISGRGTVVTGRVERGVI
KVGEEVEIVGIKDTTKSTCTGVEMFRKLLDQGQAGDNIGALLRGVKRDDVERGQVLAAPK
SITPHRKFKAEVYVLSKEEGGRHTPFFSGYRPQFYFRTTDITGVITLEEGVEMVMPGDNA
TFNVELIAPIAMELGLRFAIREGGRTVGAGVVSEIVE