Protein Info for DVU2914 in Desulfovibrio vulgaris Hildenborough JW710

Name: prfA
Annotation: peptide chain release factor 1 (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 TIGR00019: peptide chain release factor 1" amino acids 2 to 352 (351 residues), 547.5 bits, see alignment E=6.3e-169 PF03462: PCRF" amino acids 10 to 201 (192 residues), 261.4 bits, see alignment E=5.4e-82 PF00472: RF-1" amino acids 208 to 318 (111 residues), 149 bits, see alignment E=5.5e-48

Best Hits

Swiss-Prot: 100% identical to RF1_DESVV: Peptide chain release factor 1 (prfA) from Desulfovibrio vulgaris subsp. vulgaris (strain DP4)

KEGG orthology group: K02835, peptide chain release factor 1 (inferred from 100% identity to dvl:Dvul_0451)

Predicted SEED Role

"Peptide chain release factor 1" in subsystem LMPTP YwlE cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727E1 at UniProt or InterPro

Protein Sequence (357 amino acids)

>DVU2914 peptide chain release factor 1 (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MFAKLENLELKFEDLEQQLSSAEVFNDQDRYRKLTKAHADLKQVVDAFRRYKEMKQNLAD
NKELLGDSDHEIRAMAHEEIKAIEAALPDIEQELKILLLPRDPMDDKNILLEIRAGTGGE
EASLFAADLFRMYTRYAEIMGWKVEVLSASDSDTGGYKEIIALIAGDKVYSRLKYESGTH
RVQRVPATEAQGRIHTSAATVAVMPEAEEVDVDIRPDDLRIDVYRASGAGGQHVNKTESA
VRITHLPTGIVVACQDEKSQHKNKAKAMKVLISRVLQAEQERAHSVIADARRALVGSGDR
SERIRTYNYPQSRITDHRINLTLYSLDKVMEGELAPLVDALVTHAQTEALKAQADAS