Protein Info for DVU2906 in Desulfovibrio vulgaris Hildenborough JW710

Name: umuC
Annotation: umuC protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 PF00817: IMS" amino acids 45 to 189 (145 residues), 125.8 bits, see alignment E=2.1e-40 PF11799: IMS_C" amino acids 283 to 398 (116 residues), 79.6 bits, see alignment E=3.6e-26 PF13438: DUF4113" amino acids 413 to 464 (52 residues), 73.1 bits, see alignment 2.3e-24

Best Hits

KEGG orthology group: K03502, DNA polymerase V (inferred from 100% identity to dvu:DVU2906)

Predicted SEED Role

"Error-prone, lesion bypass DNA polymerase V (UmuC)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727E9 at UniProt or InterPro

Protein Sequence (467 amino acids)

>DVU2906 umuC protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MHGPPESQEPCGTFGPDETTGATSTAASRGEARRLPRGGVLWALVDCNNFYASCERLFRP
DLKGRPVVVLSNNDGCVIARSAEAKALGVPMGAPEFKVRDMLRAHDVAVFSSNYALYGDL
SQRVMRTLATVVPRVEVYSIDEAFIPLPAALAADPVAVGRTLRQRVAQWVGIPVSVGVGP
TRTLAKLANRLSKQDSAYGNVFDLTPETVDMDRVLASVDVGDVWGVGRRSAEMLRGRGIL
TARALRDADPLWVRQRMTVTGWRTQQELRGMPCLTDDDLPVPRRSIRSSRSFGQMVRTLE
PLREAVATFTARAVAKARAEGLVASCIEVHIRTPRHTERPRYDETTTITLPCPTADTGLC
IRHALTGLERIFREGYLYAKAGVTLFGLEPAAGRQGSLLDLLDGSHEHKARRERLMAALD
AVNLRHGRGSIRHGAEGDPGAAWHMSQKYRSPRYTTAWEELPEVLCR