Protein Info for DVU2905 in Desulfovibrio vulgaris Hildenborough JW710
Annotation: alcohol dehydrogenase, iron-containing (TIGR)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00001, alcohol dehydrogenase [EC: 1.1.1.1] (inferred from 100% identity to dvu:DVU2905)Predicted SEED Role
"NADH-dependent butanol dehydrogenase A (EC 1.1.1.-)" in subsystem Butanol Biosynthesis (EC 1.1.1.-)
MetaCyc Pathways
- hexitol fermentation to lactate, formate, ethanol and acetate (16/19 steps found)
- superpathway of anaerobic sucrose degradation (15/19 steps found)
- 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
- pyruvate fermentation to ethanol I (3/3 steps found)
- pyruvate fermentation to ethanol III (3/3 steps found)
- ethanol degradation I (2/2 steps found)
- superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
- mixed acid fermentation (12/16 steps found)
- acetylene degradation (anaerobic) (4/5 steps found)
- ethanolamine utilization (4/5 steps found)
- pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
- acetaldehyde biosynthesis I (1/1 steps found)
- heterolactic fermentation (13/18 steps found)
- L-isoleucine degradation II (2/3 steps found)
- L-leucine degradation III (2/3 steps found)
- L-valine degradation II (2/3 steps found)
- ethanol degradation II (2/3 steps found)
- pyruvate fermentation to ethanol II (1/2 steps found)
- (S)-propane-1,2-diol degradation (3/5 steps found)
- superpathway of N-acetylneuraminate degradation (15/22 steps found)
- L-phenylalanine degradation III (2/4 steps found)
- L-tyrosine degradation III (2/4 steps found)
- phytol degradation (2/4 steps found)
- salidroside biosynthesis (2/4 steps found)
- L-methionine degradation III (1/3 steps found)
- phenylethanol biosynthesis (2/5 steps found)
- glycerol degradation to butanol (9/16 steps found)
- butanol and isobutanol biosynthesis (engineered) (3/8 steps found)
- serotonin degradation (2/7 steps found)
- pyruvate fermentation to butanol II (engineered) (1/6 steps found)
- pyruvate fermentation to butanol I (2/8 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (15/27 steps found)
- superpathway of Clostridium acetobutylicum solventogenic fermentation (4/13 steps found)
- noradrenaline and adrenaline degradation (2/13 steps found)
- L-tryptophan degradation V (side chain pathway) (1/13 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- 3-Chloroacrylic acid degradation
- Alkaloid biosynthesis I
- Aminosugars metabolism
- Ascorbate and aldarate metabolism
- Benzoate degradation via CoA ligation
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of type II polyketide products
- Biosynthesis of unsaturated fatty acids
- Bisphenol A degradation
- Butanoate metabolism
- C21-Steroid hormone metabolism
- Drug metabolism - cytochrome P450
- Fatty acid metabolism
- Fructose and mannose metabolism
- Glycine, serine and threonine metabolism
- Glycolysis / Gluconeogenesis
- Insect hormone biosynthesis
- Linoleic acid metabolism
- Metabolism of xenobiotics by cytochrome P450
- Nucleotide sugars metabolism
- Polyketide sugar unit biosynthesis
- Retinol metabolism
- Tetrachloroethene degradation
- Tyrosine metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.-, 1.1.1.1
Use Curated BLAST to search for 1.1.1.- or 1.1.1.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q727F0 at UniProt or InterPro
Protein Sequence (392 amino acids)
>DVU2905 alcohol dehydrogenase, iron-containing (TIGR) (Desulfovibrio vulgaris Hildenborough JW710) MKDFVYHNPTEVRFGRGVVASLGARVRAAGLSAVVVVAGGGAARRCGAFGDAVTSLEAAG VAWTPCEGVRPNPDLDGVLRAVQALRDAGAGGFVAVGGGSVMDTAKAAGVCALHDGDPWD HFTRRTTATAAVPVFTVPTLSGTGAEMNGTAVITNMAQQRKWSLRGPTPVAAFLDPVYQR DVPLALAVGCAVDAMTHVLEFAVAGTPCVDAKALDIPGGTYFMEETVLAQNEALLRSIIR SVEVLRRIPGDYAARASLAWAAGLGLCGLTGVGLGGGSWVSHALEHAVSGHFPQVPHGPA LAVLFPCWMEEVASEHTPMFERLARNVWGVEGAVEGIRAMRATFDRWGAPRRLAAWGVGE DAIPGLVRAALEYPRPLGLAPERVERIFRSAL