Protein Info for DVU2904 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: radical SAM enzyme, Cfr family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF21016: RlmN_N" amino acids 2 to 62 (61 residues), 72.8 bits, see alignment E=1.5e-24 TIGR00048: 23S rRNA (adenine(2503)-C(2))-methyltransferase" amino acids 3 to 353 (351 residues), 403.9 bits, see alignment E=2.8e-125 PF04055: Radical_SAM" amino acids 112 to 281 (170 residues), 60 bits, see alignment E=3.4e-20

Best Hits

Swiss-Prot: 100% identical to RLMN_DESVH: Dual-specificity RNA methyltransferase RlmN (rlmN) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K06941, ribosomal RNA large subunit methyltransferase N [EC: 2.1.1.-] (inferred from 100% identity to dvl:Dvul_0461)

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase N (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727F1 at UniProt or InterPro

Protein Sequence (364 amino acids)

>DVU2904 radical SAM enzyme, Cfr family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTDILNLTYEELEAFMTAELGEPRFRARQVWQWLWQKCARSFDEMTNVSKATRARLAEKA
VITWPEVETVQKSADGTTKFLLRLADGALVETVLIPSASREGTLRITQCLSCQVGCAMGC
TFCSTGTMGFERNMTMGEILGQVLVARAHLGDSRPDHPILRNLVFMGMGEPLLNLNEVMR
SLRTLNDEFGLSFSPRRITVSTCGIEKGLRELGESGLAFLAVSLHAPNQEIRKRIMPKAA
HWHLDDLITALESYPLKTRERVTFEYLLLGGVNDGIEHARELVRLVSRTKGKLNLIVYNP
AEGDPYDAPTPERILAFEQYLWSKNITAIIRKSKGQDIKAACGQLKASELQRGTASAGAD
APEA