Protein Info for DVU2902 in Desulfovibrio vulgaris Hildenborough JW710

Name: pyrC
Annotation: dihydroorotase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 TIGR00857: dihydroorotase, multifunctional complex type" amino acids 17 to 419 (403 residues), 388.7 bits, see alignment E=1.7e-120 PF12890: DHOase" amino acids 48 to 237 (190 residues), 99 bits, see alignment E=3.1e-32 PF01979: Amidohydro_1" amino acids 50 to 419 (370 residues), 74.7 bits, see alignment E=8.5e-25

Best Hits

Swiss-Prot: 46% identical to PYRC_GEOUR: Dihydroorotase (pyrC) from Geobacter uraniireducens (strain Rf4)

KEGG orthology group: K01465, dihydroorotase [EC: 3.5.2.3] (inferred from 100% identity to dvu:DVU2902)

Predicted SEED Role

"Dihydroorotase (EC 3.5.2.3)" in subsystem De Novo Pyrimidine Synthesis (EC 3.5.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727F3 at UniProt or InterPro

Protein Sequence (422 amino acids)

>DVU2902 dihydroorotase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSDILFLRNARLLGTPVDLIARDGVIAAIGEHGTLDTPADATVHDAGGHILFPSFIDAHV
HLREPGFEYKEDIASGLAAAAHGGFGAVMCMANTRPVNDDAAVTRHIIETSLRHWPHGPR
VYPVGAATVGLKGTELAPMAELAAAGCAAFSNDGAPVPDTEMFRRAVEYAADLGRVVIDH
CEDPYLAKGAHMNEGATSGRVGVKGQPDVGEALHVARDILLADYLGLPIHLAHISCRRSV
ELIAWAKVRGVPVTAETCPHYLILDDTALENYDTNAKVNPPLRTPDDVAALREAVKSGVI
DMFVTDHAPHAAHEKETPLDEAPNGISGLDTAVALTWGLVREGLLTEGDLVRLWNREPAR
VFGLPRNGFEPGDPADFFLFDPDEAWVVSRETMHSKSCNTPFLGHTLTGRVKAHWMGGRR
IA