Protein Info for DVU2891 in Desulfovibrio vulgaris Hildenborough JW710

Name: nikR
Annotation: nickel responsive regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 PF01402: RHH_1" amino acids 6 to 45 (40 residues), 33.7 bits, see alignment E=2.4e-12 PF08753: NikR_C" amino acids 56 to 132 (77 residues), 120.7 bits, see alignment E=2.5e-39

Best Hits

Swiss-Prot: 100% identical to NIKR_DESVH: Putative nickel-responsive regulator (DVU_2891) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K07722, CopG family transcriptional regulator, nickel-responsive regulator (inferred from 100% identity to dvl:Dvul_0474)

Predicted SEED Role

"Nickel responsive regulator NikR" in subsystem Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727G4 at UniProt or InterPro

Protein Sequence (139 amino acids)

>DVU2891 nickel responsive regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MGRTIRFGVSLDSELLDKFDVLCDERCYQTRSEAIRDLIRNTLVQQEWEDTDREIAGTLT
LVYDHHKSDLAQRLTEIQHDVHDIIITSLHVHLDHYNCLEVLVLKGPGQQVRNLAQRLIS
TKGVKHGKLSLTTTGQDLT