Protein Info for DVU2889 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: BioY family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 35 to 52 (18 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 150 to 174 (25 residues), see Phobius details PF02632: BioY" amino acids 33 to 176 (144 residues), 145.4 bits, see alignment E=5.7e-47

Best Hits

KEGG orthology group: K03523, putative biotin biosynthesis protein BioY (inferred from 100% identity to dvl:Dvul_0476)

Predicted SEED Role

"Substrate-specific component BioY of biotin ECF transporter" in subsystem Biotin biosynthesis or ECF class transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727G6 at UniProt or InterPro

Protein Sequence (182 amino acids)

>DVU2889 BioY family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPESPLADIHRLVWTSLMAALIAVGAMTVIPVGPVPVTLQTLFVLLAGFVLGPRGGAYAM
LLYIAAGALGLPVFAGGKSGLAVLFGPTGGYLAGFVVMAWCAGMGGRRREGGRMTVVVAA
AWALAGLAVAYGLGALRLMSVLDIGMGRAFAVGVLPFLPGDLLKIVAAVAAWRYLRDRRL
LP