Protein Info for DVU2884 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: peptidase, M18 family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 PF02127: Peptidase_M18" amino acids 35 to 464 (430 residues), 285.2 bits, see alignment E=9.1e-89

Best Hits

KEGG orthology group: K01267, aspartyl aminopeptidase [EC: 3.4.11.21] (inferred from 100% identity to dvl:Dvul_0481)

Predicted SEED Role

"peptidase, M18 family"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727H1 at UniProt or InterPro

Protein Sequence (467 amino acids)

>DVU2884 peptidase, M18 family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTLDLAFSTRNCWETYASQTDAAAMNDLATRYVDFLSRCKTERETIDYVVERLRTAGYTE
NFAHDRVYRVFKGKTVFIARKGRQPLSQGMRLIGAHADTPRLDLKQRPLQEQAGVGQAKT
HYYGGIRKYQWLARPLAIHGVVVREDGTTVQVTLGEDVTEPVFTIADLLPHLAQKQSGQT
VADAFEAEKLNIVMGHRPQPKPETAGDEADAKDAPEAKDPIKARVLALLHEKYAIREEDL
YSAELQAVPAGPARFVGLDGSLVGGYGQDDRICVFAALEALLNAENPAAPQCVLFWDKEE
IGSEGSTGAKSKFFEYCVEDLIQSWQPAARFSDVMLNTRAVSADVHAALDPDWQELHEKL
NAATMGHGPVFCKFTGHRGKYEANDAHPEYVGWLRGVLNERGIPWQMAELGKVDQGGGGT
VAMYLAAYGMDIIDFGPAVLSMHSPFELASVADLYATRLAYTAFLER