Protein Info for DVU2850 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: tail protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 PF10076: Phage_Mu_Gp48" amino acids 12 to 196 (185 residues), 118.1 bits, see alignment E=1.5e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2850)

Predicted SEED Role

"FIG121501: Prophage tail protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727K5 at UniProt or InterPro

Protein Sequence (208 amino acids)

>DVU2850 tail protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRPYTEDDYAAQLLQLLPQGPAWPRDPEAVLTALARALAMEPARVDATGHRLLAEMDPAQ
ALVLLPEWERVCGLPDGCSQPGETIAERRENVVLRLSARGGQTPDYYAELATLLAGGVCT
VREYRPFRVGHSAVGQPLSNGAWVHTFTIGAPSVPVRGFAVGAGAAGEPLRRWGHERLEC
VIRRLKPAHTHVIFTYGAASAQQGATHA