Protein Info for DVU2827 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sigma-54 dependent transcriptional regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 PF00989: PAS" amino acids 6 to 111 (106 residues), 29 bits, see alignment E=4.1e-10 TIGR00229: PAS domain S-box protein" amino acids 7 to 120 (114 residues), 39.2 bits, see alignment E=3.4e-14 PF08448: PAS_4" amino acids 12 to 113 (102 residues), 36.3 bits, see alignment E=2.6e-12 PF13426: PAS_9" amino acids 16 to 112 (97 residues), 39.3 bits, see alignment E=3e-13 PF00158: Sigma54_activat" amino acids 151 to 314 (164 residues), 226.8 bits, see alignment E=6e-71 PF14532: Sigma54_activ_2" amino acids 152 to 320 (169 residues), 58.5 bits, see alignment E=3.9e-19 PF07728: AAA_5" amino acids 171 to 291 (121 residues), 22.4 bits, see alignment E=4.9e-08 PF18024: HTH_50" amino acids 413 to 455 (43 residues), 30.4 bits, see alignment 1.1e-10 PF02954: HTH_8" amino acids 418 to 455 (38 residues), 25.8 bits, see alignment 3.3e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2827)

Predicted SEED Role

"Sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727M8 at UniProt or InterPro

Protein Sequence (473 amino acids)

>DVU2827 sigma-54 dependent transcriptional regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKKIIEHIESIFDILSDGIYITQRDGTTLLVNRMYEQLTGLSFKDLRGRNVHDLVADGIF
DTILNPEVVRTKRPAVSVQHVRQSKKIILRGYPVFDEHGEVCLVVTFARDITMITQFREQ
IAQQKQLIETFNDRIECMLHEQVRNSQPVFESEVMQQVLDLLQRVAATDANILILGETGV
GKDVFARLAHEYSPRSSKMFLKVDCGSIAENLIESELFGYVPGAFSGASSKGKAGYFEIA
DGGTVFLDEIGELPLPMQAKLLRVLQDREVMRVGSSQARKVDVRIIAATNRDLAEDAKAG
KFRSDLYYRLNVAVLDLPPLRERQQDIIPLVERFLDRFNAKYRRNMTLPKGTRQALQNYK
WPGNVREMQNLIQSLVVTCEGHSIKPEHLPPHIQKAARNRTAYTPPAPDDARPLKEIMAD
IEREILEEAVRTHGSVCKVARMYKISRTTLFRKLRGSSLAGVSGDEEQENTGQ