Protein Info for DVU2809 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: cytochrome c3 (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF02085: Cytochrom_CIII" amino acids 31 to 129 (99 residues), 62.1 bits, see alignment E=2.8e-21

Best Hits

Swiss-Prot: 100% identical to CYC32_DESVH: Cytochrome c3 (DVU_2809) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2809)

MetaCyc: 100% identical to type I cytochrome c3 (Desulfovibrio vulgaris)
1.2.2.3-RXN [EC: 1.17.2.3]; 1.17.2.3 [EC: 1.17.2.3]

Predicted SEED Role

"cytochrome c3"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727P6 at UniProt or InterPro

Protein Sequence (144 amino acids)

>DVU2809 cytochrome c3 (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRYLVISLFAVSLLMAGSALVGNAADAAKAPKKAIELKHGTSKRMHVMFNHTTHKDIACE
QCHHDSPAPDKPYASCTDNDCHATPGPRERDTMSMFVAYHAKDTDRSCYGCHKKMAAQHP
EFTGCRPCHMSQQARKEAAASEKK