Protein Info for DVU2795 in Desulfovibrio vulgaris Hildenborough JW710

Name: nqr4
Annotation: NADH:quinone oxidoreductase subunit RnfE (Shelley Haveman)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 38 to 58 (21 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 170 to 193 (24 residues), see Phobius details PF02508: Rnf-Nqr" amino acids 5 to 185 (181 residues), 219.5 bits, see alignment E=1.6e-69 TIGR01948: electron transport complex, RnfABCDGE type, E subunit" amino acids 6 to 194 (189 residues), 240.8 bits, see alignment E=4.8e-76

Best Hits

Swiss-Prot: 50% identical to RNFE_ACEWD: Na(+)-translocating ferredoxin:NAD(+) oxidoreductase complex subunit E (rnfE) from Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1)

KEGG orthology group: K03613, electron transport complex protein RnfE (inferred from 100% identity to dvl:Dvul_0519)

MetaCyc: 50% identical to Rnf complex RnfE subunit (Acetobacterium woodii)
TRANS-RXN-276 [EC: 7.2.1.2]

Predicted SEED Role

"Electron transport complex protein RnfE" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727R0 at UniProt or InterPro

Protein Sequence (223 amino acids)

>DVU2795 NADH:quinone oxidoreductase subunit RnfE (Shelley Haveman) (Desulfovibrio vulgaris Hildenborough JW710)
MQQIIKEFTKGLWQELPPFRLVLGLCPTLAVTKTASNGLGMGLAVIFVLALSNMIISMVR
NIIPKKVRIACFIAISASLVVAVELLMQAYAYPLYQQLGIFVPLIVVNCIILGRAEAFAA
KNPVSLSLADGLGIGLGFTLSLVFLGGIRELFGTGMLFGTQVMWQGYQPFGIMVEAPGAF
ICLGLTLAAMNVINTWQARRKGLEAPENPQSGCAACRACAGIK