Protein Info for DVU2792 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: NADH:quinone oxidoreductase subunit RnfC (Shelley Haveman)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 PF13237: Fer4_10" amino acids 322 to 373 (52 residues), 26.1 bits, see alignment 7.1e-10

Best Hits

KEGG orthology group: K03615, electron transport complex protein RnfC (inferred from 100% identity to dvu:DVU2792)

Predicted SEED Role

"Electron transport complex protein RnfC" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727R3 at UniProt or InterPro

Protein Sequence (401 amino acids)

>DVU2792 NADH:quinone oxidoreductase subunit RnfC (Shelley Haveman) (Desulfovibrio vulgaris Hildenborough JW710)
MRQRFQILNDPRFHLVYGVTERFCEAPAPSKVRLNREGFTLVAGLKKKSVVHPGMLLAEH
PSPAKGDLFASIHGVVTDITERSIFVSAAEPAEDVPVVEPVDLLAQGLEGEELALAVKKL
GVNTRSLGRKCKTLIINALNPDPGVTWAEPMLQTHVNNLRVGMELHRRMSRAEKVVIALP
KGSQLVFDGITTAYVEPEYPNSIDKLVVKAVTGLENPDDVGVVGLHNIWSLGRVGRLGTP
LIETVLTIASSTKSGNYIVRAGSTIGELLEVAGIELQDGDTVVRGGPLRGESLDRLDRSV
TKGTYGLFVVEKGAVPPMKGHNPCISCGACELVCPANINPSNLSRYAEFALHERSQAAHI
DSCLECGLCGYVCITRRPVLQYIRLSKQKLAEKTVCHFVEL