Protein Info for DVU2789 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: Gpr1/Fun34/YaaH family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 transmembrane" amino acids 9 to 25 (17 residues), see Phobius details amino acids 30 to 54 (25 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 121 to 139 (19 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details PF01184: Gpr1_Fun34_YaaH" amino acids 3 to 175 (173 residues), 155.1 bits, see alignment E=1e-49

Best Hits

Swiss-Prot: 60% identical to SATP_SHIFL: Succinate-acetate/proton symporter SatP (satP) from Shigella flexneri

KEGG orthology group: K07034, (no description) (inferred from 100% identity to dvu:DVU2789)

MetaCyc: 60% identical to acetate/succinate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN0-571

Predicted SEED Role

"FIG00604709: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727R6 at UniProt or InterPro

Protein Sequence (183 amino acids)

>DVU2789 Gpr1/Fun34/YaaH family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
METRYANPAPLGLMGFGMTTVLLNIHNAGFFPISAMVLAMGIFYGGLAQVIAGIMEFRKG
NTFGTTAFTSYGLFWLSLVGLIVMPRLGWAEATPHAYMGWYLFMWGVFTLFMLLGTLRSS
VVLRLIFLLLTVLFFLLAARDWTGSETIGTIAGWEGILTGACAIYLAMAEVLHEQLGRKV
LPF