Protein Info for DVU2788 in Desulfovibrio vulgaris Hildenborough JW710

Name: smtB
Annotation: transcriptional regulator, ArsR family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 PF12840: HTH_20" amino acids 41 to 88 (48 residues), 29.7 bits, see alignment E=5.1e-11 PF01022: HTH_5" amino acids 43 to 87 (45 residues), 54.5 bits, see alignment E=8.5e-19

Best Hits

Swiss-Prot: 38% identical to SMTB_SYNE7: Transcriptional repressor SmtB (smtB) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2788)

Predicted SEED Role

"Transcriptional regulator, ArsR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727R7 at UniProt or InterPro

Protein Sequence (120 amino acids)

>DVU2788 transcriptional regulator, ArsR family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRDDTPVCEQHCEHGDIIARVRSRLSPDADVTALSTVFKLMGDPTRLRILEALSMDELCV
CDLAALLCLTQSAVSHQLRLLRASKLVRFRREGKNAFYSLDDDHVRTLFRQGLEHVRERT