Protein Info for DVU2784 in Desulfovibrio vulgaris Hildenborough JW710

Name: lldD
Annotation: dehydrogenase, FMN-dependent family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 PF01070: FMN_dh" amino acids 35 to 178 (144 residues), 45.2 bits, see alignment E=7e-16 amino acids 207 to 337 (131 residues), 165.4 bits, see alignment E=2e-52 PF01645: Glu_synthase" amino acids 258 to 297 (40 residues), 22.4 bits, see alignment 6.4e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_0528)

Predicted SEED Role

"dehydrogenase, FMN-dependent family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727S1 at UniProt or InterPro

Protein Sequence (341 amino acids)

>DVU2784 dehydrogenase, FMN-dependent family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKEIRDKARQLMKGYCRVCPVCDGRACAGEVPGMGGLGTGNAFRNNLSALAAVRLNMRLV
HGVSAPDTRTTLLGLDLDMPVLAAPIGGVSFNMGGGVSEEDYIDAIVRGCNERGLVGCTG
DGVPPFIHESGFAAITAAGGRGIPFVKPWDGDELDQKLDKALATGCKVLGMDVDAAGLIT
LRKMGRPVAPKTAEELAAIVTKVHGAGARFILKGIMCADDALRAAEVGVDAIVVSNHGGR
VLDHTPGTAEVLPAIADAVKGRLAVLVDGGVRDGVDVFKMLALGADAVMIGRPFSIAAVG
GLAEGVASYVDTLKAQLVQAMILTGSADVAGISRAALYGKV