Protein Info for DVU2776 in Desulfovibrio vulgaris Hildenborough JW710

Name: dsrC
Annotation: dissimilatory sulfite reductase, gamma subunit (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03342: sulfur relay protein, TusE/DsrC/DsvC family
  • amino acids 5 to 105 (101 residues), 118 bits, E=1.2e-38
• PF04358: DsrC
  • amino acids 6 to 105 (100 residues), 117.4 bits, E=2.1e-38

Best Hits

Swiss-Prot: 100% identical to DSVC_DESVH: Sulfite reductase, dissimilatory-type subunit gamma (dsvC) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K11179, tRNA 2-thiouridine synthesizing protein E [EC: 2.8.1.-] (inferred from 100% identity to dvl:Dvul_0534)

MetaCyc: 100% identical to DsvC monomer (D. vulgaris) (Desulfovibrio vulgaris)

Predicted SEED Role

"Dissimilatory sulfite reductase, gamma subunit (EC 1.8.99.3)" (EC 1.8.99.3)

KEGG Metabolic Maps

• Trinitrotoluene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.99.3, 2.8.1.-

Use Curated BLAST to search for 1.8.99.3 or 2.8.1.-

Sequence Analysis Tools

See P45573 at UniProt or InterPro

Protein Sequence (105 amino acids)

>DVU2776 dissimilatory sulfite reductase, gamma subunit (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAEVTYKGKSFEVDEDGFLLRFDDWCPEWVEYVKESEGISDISPDHQKIIDFLQDYYKKN
GIAPMVRILSKNTGFKLKEVYELFPSGPGKGACKMAGLPKPTGCV