Protein Info for DVU2771 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: conserved hypothetical protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details transmembrane" amino acids 98 to 121 (24 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details PF04280: Tim44" amino acids 196 to 318 (123 residues), 60 bits, see alignment E=1.5e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2771)

Predicted SEED Role

"FIG00602622: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727T3 at UniProt or InterPro

Protein Sequence (321 amino acids)

>DVU2771 conserved hypothetical protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSACAVAPRAMTHFRKSFFVAAFCAALVLCMSPLADAKRMGGGGSFGSRPSMQRSFTPTP
QQAPQMQRQQTPTQQGINQQNPGAAQQPGMAQQPRRGLFGGMGGFLGGMLAGGLLGSLFF
GGGFGGMPGILDMLLLALVAYGIFKFISMRRQAANPQPAAAGYGAHTSPSDNDNGWGTLR
SAPQGGTTYQEQAGPEVPAGFDIEQFIKGAKMAFTRLQASWDKRDLEDISQFSTPAVLDE
IRRQAEADPVPSTTEILLVNANLLGVVEENGQQTATVFFDVLLREDPRQDAPTSVREVWH
FVRPVKGTGMWQLDGIQQVDQ