Protein Info for DVU2751 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: hypothetical protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 transmembrane" amino acids 40 to 60 (21 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details PF07291: MauE" amino acids 42 to 171 (130 residues), 82.2 bits, see alignment E=4.1e-27 PF07681: DoxX" amino acids 43 to 122 (80 residues), 27.7 bits, see alignment E=3.6e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2751)

Predicted SEED Role

"FIG00602762: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727V3 at UniProt or InterPro

Protein Sequence (186 amino acids)

>DVU2751 hypothetical protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQHHKNNRFDGCASIVDHRTMSVQTTVISPSRLRDFALARPVLFTVRLALAAVYIIAGAT
KLYDVRGFAEIVNMYGIVPIDLLPFVALLLPLVEVVAGVALLAGRDWGLALVTALTVLFL
AVLGYAIWSGLSIGDCGCFAPGDIPSGHDDGSALKEAFIRDLLLLAGSLHLYLGRHTRAA
LHVPHP