Protein Info for DVU2743 in Desulfovibrio vulgaris Hildenborough JW710

Name: livH
Annotation: high-affinity branched-chain amino acid ABC ransporter, permease protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 42 to 65 (24 residues), see Phobius details amino acids 71 to 95 (25 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 201 to 225 (25 residues), see Phobius details amino acids 231 to 249 (19 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 7 to 290 (284 residues), 123.6 bits, see alignment E=4.3e-40

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to dvu:DVU2743)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727W1 at UniProt or InterPro

Protein Sequence (306 amino acids)

>DVU2743 high-affinity branched-chain amino acid ABC ransporter, permease protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
METFIQNIFNALQWGSFYALIALGYTLVYGVLLLINFAHGDIFMVGAYISFFVASILLGQ
IGGFFELSGPMALALTVPLTMVLTAGVGVTLERVAYRPLRRKGAHRLYVVITALMCGIML
ENGNLALLGASRKALPEMIDKVVYTIGTVSVTNLKLMVIVTAFLVFALLQFIVTRTRIGM
AMRAVAWDKFALPLMGIPLDSIIVFTFVLGSGFAGLAGLLFAMSYPILDPYMGAMVGWKA
FIAAVVGGIGDIRGAFIGGFLLAFIEIMVAAVFPSTFRDLFAFSILLFIMWQRPTGLFGV
AKTTKI