Protein Info for DVU2737 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: RNA methyltransferase, TrmH family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF00588: SpoU_methylase" amino acids 5 to 156 (152 residues), 105 bits, see alignment E=1.9e-34

Best Hits

KEGG orthology group: K02533, tRNA/rRNA methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to dvu:DVU2737)

Predicted SEED Role

"tRNA:Cm32/Um32 methyltransferase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727W7 at UniProt or InterPro

Protein Sequence (254 amino acids)

>DVU2737 RNA methyltransferase, TrmH family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLPGLTVVMVKTRFPENVGMVARACVNMGAQDIVLVDPERWEIDKARPLATAKGEPLLER
VKVVGTLSEAVADCTAVWGTTARTGGWRREILTPEKAGPEMAASLADGERVALLLGPEDR
GLNNDEIEHCTRLLTIPTAPEASSLNVAQASLIVLYECHKASLAHPFRPGPGPESRRITQ
DENELLLATLRDMLLDIDFLRHDNPDYFMMPVRRFMGKAGLRRHEFDMLMGVCRQVRRVA
TLARDRNRPDSPAS