Protein Info for DVU2683 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: L-lactate permease family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 46 (17 residues), see Phobius details amino acids 52 to 76 (25 residues), see Phobius details amino acids 103 to 169 (67 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 276 to 300 (25 residues), see Phobius details amino acids 326 to 345 (20 residues), see Phobius details amino acids 364 to 381 (18 residues), see Phobius details amino acids 418 to 438 (21 residues), see Phobius details amino acids 450 to 472 (23 residues), see Phobius details amino acids 492 to 515 (24 residues), see Phobius details PF02652: Lactate_perm" amino acids 5 to 513 (509 residues), 148.2 bits, see alignment E=1.9e-47

Best Hits

KEGG orthology group: K03303, lactate transporter, LctP family (inferred from 100% identity to dvl:Dvul_0574)

Predicted SEED Role

"L-lactate permease" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728C1 at UniProt or InterPro

Protein Sequence (516 amino acids)

>DVU2683 L-lactate permease family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MYTASVLLAFLPVVAIFLLLLVYRVAADTAGYIGWGVAALVAIFWFDTPVQVVLLASAAG
LVASLPITLVMGASILQISVMQETGAVARVVALMKSIAPGQQAVQIMLINVGFGILLTSL
GAVTVSILPPIMLALGYSTMTAILLPAIGYDALCTYALLGIPAVVYANFVGQPVNEVGGY
FARYMPVISTCIALGMLQLTGGMKMVRKGLVPALVAGLTAGFTAIFMARLGLVTITGIAA
GLAVIAVLMLYIRLTGKPLRDRNLLAENDLAAERHLSLAAACSPWILLTVVSLVLNAPFL
PFFDFTFKQLSMPVEIIPRSPERIRLFWQAYFWVIVCTFAALPFLKATKAQVTSALGKAG
KRALRPMMSASVFFAIAYVMNHSGKTPDWVLADKLHNMVYLMADASAATFGKFYPLVAPY
LGLLGGFISGSESSSIAMLTKLHLSTSESIGASGLLVAAASGIGGGLASVISPAKLQNAA
ASIDRIRDAAQAIRPAFVIAMLITGVCSVMTMFWAY