Protein Info for DVU2677 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensor histidine kinase/response regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 PF00072: Response_reg" amino acids 6 to 117 (112 residues), 43.8 bits, see alignment E=3.9e-15 amino acids 128 to 237 (110 residues), 87.4 bits, see alignment E=1.1e-28 PF00512: HisKA" amino acids 260 to 327 (68 residues), 61.7 bits, see alignment E=8.1e-21 PF02518: HATPase_c" amino acids 373 to 483 (111 residues), 98.1 bits, see alignment E=6.3e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2677)

Predicted SEED Role

"sensor histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728C6 at UniProt or InterPro

Protein Sequence (487 amino acids)

>DVU2677 sensor histidine kinase/response regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSSPRILIVEDSPSTLRELRRALETELGFTVLTAGSLAEARSVLDHHGPDFFLAVLDLVL
PDASDGEIVAAVRAYDIPVVVFTSQFDEATRHSILAQDVIDYFIKNECAIGDLTAAVSRL
WRNRNTRILVVDDSTSMRTFLKDELRRYMFQVFEASSGATALRLLERNPDIAVVITDYLM
PGMDGLELTRRIRNRWGRETVAVIGVSVQSEMPLTVSFIKNGANDFLTKPFHREELYCRT
VMNVEMVERSRSLIELNDLKNRFLGMAAHDLRNPINGIRGFTRMLLDGILGPLNTDQRGI
LSTVHEASNDMLLLVNDLLDVTVIESGTLELDIVPGPLQELVRERISFAVLAAGAKNIQI
IQNIDDIEGCAYDNRRMAQVFDNLLSNAIKFTPADSAVRVALHREGDKAVFSVSDEGPGI
KAEERELLFESFRKLSARPTGGESSTGLGLTIVNRIVTAHGGSVWVDDAPASGATFHVSL
PLTPSPA