Protein Info for DVU2671 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: HDIG/HD/KH domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 signal peptide" amino acids 5 to 5 (1 residues), see Phobius details transmembrane" amino acids 6 to 23 (18 residues), see Phobius details PF12072: RNase_Y_N" amino acids 5 to 204 (200 residues), 203.5 bits, see alignment E=3.8e-64 TIGR03319: ribonuclease Y" amino acids 8 to 519 (512 residues), 770.7 bits, see alignment E=6.3e-236 PF00013: KH_1" amino acids 215 to 269 (55 residues), 29.8 bits, see alignment 6.1e-11 TIGR00277: HDIG domain" amino acids 332 to 408 (77 residues), 74.1 bits, see alignment E=6.6e-25 PF01966: HD" amino acids 335 to 426 (92 residues), 71.6 bits, see alignment E=1e-23

Best Hits

Swiss-Prot: 100% identical to RNY_DESVV: Ribonuclease Y (rny) from Desulfovibrio vulgaris subsp. vulgaris (strain DP4)

KEGG orthology group: K06950, uncharacterized protein (inferred from 100% identity to dvl:Dvul_0585)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728D2 at UniProt or InterPro

Protein Sequence (519 amino acids)

>DVU2671 HDIG/HD/KH domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MGLMIFAYIAIGAVLGAGTGYLLHRYVSAKRIGDANELAKRIVEEARKEAQAQKKEILLQ
GQDEIFNQKRELENEFKERERELKARDRKLEEQGERLEEKLEKATQKEHEVLAIEKELTR
KERRLATLEEELEGKIAEQDHRLEEVSGLTAEEARARIMEEVEARTRHESAKMIRVIEME
ARETADRKAKEILASAIQRYAGDYVGEQTVTAVTLPSEDMKGRIIGREGRNIRALEAATG
VDLIIDDTPETVILSAYSPLRRQVAKMALERLIQDGRIHPARIEDIVRKCEQELEVQVRE
VGEQATFDAGVHGIHPDIIKLLGQLRYRTSFSQNVLQHSLEVSALCGMMAAELGMDIKKA
KRAGLLHDIGKAVDHEVEGPHALIGADIAKKYGEGKDIIHAIAAHHEDQPPKTALAVLVQ
AADSISGARPGARKELLENYVKRLEDLENIATGFEGVSKVYAIQAGREIRVMVNSENVDD
DQTYMLCKDIAAKIEKNLTYPGQIRVTVIRERRAVGYAK