Protein Info for DVU2665 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: phosphate ABC transporter, permease protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 31 to 49 (19 residues), see Phobius details amino acids 52 to 52 (1 residues), see Phobius details amino acids 60 to 85 (26 residues), see Phobius details amino acids 91 to 119 (29 residues), see Phobius details amino acids 130 to 153 (24 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details amino acids 204 to 221 (18 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 74 to 278 (205 residues), 52.7 bits, see alignment E=2.3e-18

Best Hits

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 100% identity to dvl:Dvul_0591)

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728D8 at UniProt or InterPro

Protein Sequence (294 amino acids)

>DVU2665 phosphate ABC transporter, permease protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MMVSMTVTLVGVAALLGVVLMRGLPALGPALLFGDVSPLAAMTGAVPVWDGIWPACAGTF
ALLMVALGLAVLPGIGCGIHLALFASPRTRVLLGLAVDLLAGVPSIVMGLFGFTLLLALR
RTVAPDASTGLLLASVCLALLVLPVLVVTTRGALEALPAQLRLTGAALGLDTWGRLRHLL
LPAAGRGILGGVLLAAGRAAEDTAVIMLTGVVASVGLPAGLGERFEALPFTIFYLSSQYR
DAVELQRGFGAATVLLVLSLTLLAGAWLLQRVLERKWRGVLPVSPCQGTSEDIR