Protein Info for DVU2661 in Desulfovibrio vulgaris Hildenborough JW710

Name: CueO
Annotation: twin-arginine translocation pathway signal sequence domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 521 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF07732: Cu-oxidase_3" amino acids 105 to 193 (89 residues), 31.4 bits, see alignment E=1.7e-11 PF07731: Cu-oxidase_2" amino acids 400 to 484 (85 residues), 22.8 bits, see alignment E=6.6e-09

Best Hits

KEGG orthology group: K04753, suppressor of ftsI (inferred from 100% identity to dvu:DVU2661)

Predicted SEED Role

"Multicopper oxidase" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728E2 at UniProt or InterPro

Protein Sequence (521 amino acids)

>DVU2661 twin-arginine translocation pathway signal sequence domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPPRILHRRDILRYGLAGLLSLATHPLAWAVASERLPVTGFGARTFDTPVPLHGTPDGPA
MLEACQPLAVSIGPGAPGGNAAPFAFTMARNTAAALEESSHPGSPLLRLQSGCTFRARVS
NKLTTPCTPFWRGLLADWQTPLPASPLESGAEHTYAATVRNRAGTLLYQALTPGMAAPQV
QLGLCGLMLVEDATERLFARQYDLHLGTTDLPLLIHDCTLDGLGAYATTQAAFGNALLVN
GVIGGVIDVPAAFVRLRLANGCASRILDVALQHAGKDLPVTLIGTDCGLLPFTERVEGSF
LGPGERVEYLADLRDIPAGTDIYIVSRAFPSSYFPGRTAIPPEGTPFALLRLRVGAPTGS
RITTPAPMRLAEPFAPLPAPGGPARRVSIVWPHGLHAIDGQAWTDTPLQLPHRQRETWEF
SNAADGVPYPLYCGGLAFRVLTRRGGPPAVQARATHPEGRHPADEGLKDTVIIWPGETVR
ISLDFSVRRAPAAIPLVFGAARLDAFDAGQRRTIVLPPLTR