Protein Info for DVU2658 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: conserved hypothetical protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 TIGR04508: 7-carboxy-7-deazaguanine synthase" amino acids 3 to 216 (214 residues), 342.4 bits, see alignment E=5.2e-107

Best Hits

Swiss-Prot: 100% identical to QUEE_DESVH: 7-carboxy-7-deazaguanine synthase (queE) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2658)

Predicted SEED Role

"Queuosine Biosynthesis QueE Radical SAM" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728E5 at UniProt or InterPro

Protein Sequence (216 amino acids)

>DVU2658 conserved hypothetical protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTYRVKEIFHTLQGEGMRAGRAAVFCRFSGCNLWTGWAQDRPAAVCPFCDTDFVGTDGPG
GGVFEDAATLAAAILAAFPYKTGEGYRPYVVFTGGEPALQLDRPLIDILHAHGCEVAIET
NGTVRLPEGIDWVTVSPKAGTRLAVTSGDELKLVWPQQGICPESYESLAFTYLLMQPRDG
LGDAGRGDAESEAVRWCLAHPRWRLCLQTHKYLGIP